The short version of lyophilized powder fits in a sentence. The long version — which is the one that helps — is below.
Reviewed 2026-05-30. Anything still debated is marked as such rather than presented as settled.
Regulatory interest in AOD-9604 increased after high-profile anti-doping cases involving peptide products. In some cases, the substance was supplied under alternative names or in compounded preparations, complicating traceability. Sports tribunals and anti-doping panels have discussed whether the peptide was explicitly banned at the time of use, leading to clarifications by the World Anti-Doping Agency. For consumers and researchers, the legal status can vary by jurisdiction, and products marketed as research chemicals may lack independent quality verification.
AOD-9604 is listed as a prohibited substance in sport by the World Anti-Doping Agency. It falls under the peptide hormones, growth factors, related substances, and mimetics class on the prohibited list. Anti-doping organizations treat its presence in an athlete's sample as an adverse finding unless a therapeutic use exemption applies. The prohibition reflects concerns about performance enhancement in competitive settings and the difficulty of distinguishing exogenous peptide use from endogenous hormone fragments.
Quality varies among research-grade suppliers, so certificates of analysis and independent testing are important for verification. A typical certificate reports purity by HPLC, identity by mass spectrometry, appearance, and sometimes residual solvents or water content. AOD9604 is often sold as a research chemical not intended for human consumption, and labels can be inaccurate. Common misconceptions include treating the peptide as a form of growth hormone, assuming supplement status, or expecting approved-drug quality from unregulated products.
AOD9604 is commonly supplied as a white to off-white lyophilized powder. The powder is typically stored at -20 °C or below, protected from light and moisture, because peptides can degrade through oxidation, hydrolysis, or aggregation. If it is reconstituted for laboratory use, an appropriate aqueous buffer or solvent is chosen, and the solution is kept cold and handled to avoid repeated freeze-thaw cycles. These practices support stability but do not imply suitability for human use.
Identity and purity are usually assessed with reversed-phase high-performance liquid chromatography and mass spectrometry. Reversed-phase HPLC separates the peptide from related impurities and can estimate purity by ultraviolet absorbance, while mass spectrometry confirms the molecular mass and detects modifications. Peptide mapping, amino acid analysis, and disulfide mapping may be used when the sequence or disulfide arrangement must be verified. Because AOD9604 contains cysteine residues, oxidation and disulfide isomers are possible quality concerns in synthetic batches.
| Property | Value | Notes |
|---|---|---|
| Regulatory status | Prohibited in sport | Listed by WADA under peptide hormones |
| WADA class | S2 | Peptide hormones, growth factors, related substances, and mimetics |
| Approved therapeutic use | Not established | Clinical research did not lead to broad marketing approval |
| Common detection method | LC-MS/MS | Liquid chromatography-tandem mass spectrometry |
| Sample preparation | Extraction and enrichment | Immunoaffinity or solid-phase extraction may be used |
Identity and purity are commonly checked with reversed-phase high-performance liquid chromatography and mass spectrometry. RP-HPLC separates the peptide from related impurities and can estimate purity by peak area. Mass spectrometry confirms molecular mass and helps detect sequence variants or truncations. Some laboratories use amino acid analysis or peptide mapping for additional characterization. No single method proves biological activity; these techniques establish chemical identity and purity only. They also require suitable reference standards for confident comparison.
Commercial AOD-9604 may vary in purity, counterion content, and residual moisture. Certificates of analysis often report HPLC purity, mass confirmation, and appearance, but testing methods differ between suppliers. Independent verification is sometimes used because labeled content may not match actual peptide amount. Stability under different pH and temperature conditions is not fully standardized across studies. Researchers generally treat lyophilized material as the reference form for weighing and reconstitution. Moisture content can affect accurate mass measurement.
AOD-9604 is typically supplied as a lyophilized white to off-white powder. In this form, it is relatively stable when kept cool, dry, and protected from light. Common storage recommendations place it at −20 °C or below for long-term retention. Reconstituted solutions are less stable and are often kept at 2–8 °C for short periods. Freeze-thaw cycles should be minimized because they can promote aggregation or loss of peptide content. Vials are usually sealed under inert gas to reduce oxidation.
AOD-9604 is a synthetic peptide whose structure corresponds to a C-terminal segment of human growth hormone. It is often described as hGH fragment 176-191, a 16-amino-acid sequence. The peptide was designed to isolate a region of hGH associated with fat metabolism while avoiding the full hormone's growth-promoting actions. Laboratory and commercial materials typically present it as a lyophilized powder for research use. Its identity is defined by amino acid sequence, not by a single brand.
The fragment includes residues that can form an internal disulfide bond between two cysteine positions. This structural feature can influence how the peptide folds and how stable it is in solution. AOD-9604 differs from full-length hGH in size and receptor interactions; it does not contain the entire growth hormone sequence. Published descriptions sometimes use slightly different residue numbering, so sequence information should be checked against primary sources. The molecule is small compared with intact hGH, which affects analytical detection and purification approaches.
Proposed mechanism focuses on lipolysis, the breakdown of stored triglycerides into free fatty acids and glycerol. AOD-9604 is thought to act on adipose tissue without stimulating appetite or affecting blood sugar in the same way as growth hormone. Laboratory studies report increased fat oxidation in some models. The precise receptor interactions and signaling pathways remain incompletely characterized. Researchers have proposed that the peptide may influence fat mobilization through pathways distinct from the full hormone.
Research has examined whether the peptide affects fat mass independently of growth hormone's other actions. Early animal studies suggested reductions in body fat, but species differences and small sample sizes limit interpretation. Human studies have generally been short and have not consistently shown large effects. Some trials measured body composition, lipid profiles, and safety parameters, but the overall picture is one of suggestive yet inconclusive metabolic activity. Findings vary across study populations and protocols.
A central uncertainty is whether observed metabolic changes translate into meaningful clinical benefits. Study designs vary in dose, duration, and participant characteristics, making comparisons difficult. Independent replication is limited, and the field lacks consensus on optimal endpoints or treatment duration. Ongoing or future studies may clarify mechanism and effect size, but current evidence does not establish a clear therapeutic role. Researchers often call for larger, longer, and better-controlled trials, while questions remain about which patient groups might respond.
There are no widely accepted functions for the resulting truncated RNA transcripts. However, a study in 1981 found evidence that there was a relationship between the number of abortive transcripts produced and the time until long RNA strands are successfully produced. When RNA polymerase undergoes abortive transcription in the presence of ATP, UTP, and GTP, a complex is formed that has a much lower capacity for abortive recycling and a much higher rate of synthesis of the full-length RNA transcript. A study in 2010 found evidence that these truncated transcripts inhibit termination of RNA synthesis by a RNA hairpin-dependent intrinsic terminator. Oligonucleotide Eukaryotic transcription Bacterial transcription
Aspartate transaminase (AST) or aspartate aminotransferase, also known as AspAT/ASAT/AAT or (serum) glutamic oxaloacetic transaminase (GOT, SGOT), is a pyridoxal phosphate (PLP)-dependent transaminase enzyme (EC 2.6.1.1) that was first described by Arthur Karmen and colleagues in 1954. AST catalyzes the reversible transfer of an α-amino group between aspartate and glutamate and, as such, is an important enzyme in amino acid metabolism. AST is found in the liver, heart, skeletal muscle, kidneys, brain, red blood cells and gall bladder. Serum AST level, serum ALT (alanine transaminase) level, and their ratio (AST/ALT ratio) are commonly measured clinically as biomarkers for liver health. The tests are part of blood panels. The half-life of total AST in the circulation approximates 17 hours and, on average, 87 hours for mitochondrial AST. Aminotransferase is cleared by sinusoidal cells in the liver. Aspartate transaminase catalyzes the interconversion of the natural amino acid, L-aspartic acid and α-ketoglutaric acid to give oxaloacetic acid and L-glutamic acid.:
A particular challenge in analysing AlphaFold models is distinguishing genuine topology from structural prediction artefacts. A high confidence score does not by itself guarantee that a predicted chain crossing is correct, and incorrect modelling of termini or flexible regions may change the calculated topology. AlphaKnot 2.0 therefore provides several measures intended to help evaluate a predicted knot, including the pLDDT values of the complete chain and knot core, the confidence near the boundaries of the knot core, and detection of unusually close contacts between Cα atoms. Users can also compare AlphaFold predictions with independently generated ESMFold models for shorter proteins. Because automated analysis at the scale of the AlphaFold database cannot be manually verified structure by structure, AlphaKnot 2.0 introduced a user annotation system. Database entries can be assessed by users as a knot, artifact, or unsure, allowing potentially incorrect predictions to be flagged for further consideration.
Camurus is a company focused on the development of lipid lyotropic liquid crystal structures for pharmaceutical drug delivery applications. These structures are well-defined three-dimensional formations consisting of lipophilic and hydrophilic domains that can be either interconnected or isolated depending on the environmentally induced phase conditions. The unique crystalline structures offer a unique way of encapsulating and transporting Active pharmaceutical ingredients, such as small molecules, peptides and proteins through the body. The structures also allow for the use of controlled release and prevention of degradation of fragile short half live molecules, a serious issue for amino-acid based drugs.
Several methods have been used to determine the mechanisms of antimicrobial peptide activity. In particular, solid-state NMR studies have provided an atomic-level resolution explanation of membrane disruption by antimicrobial peptides. In more recent years, X-ray crystallography has been used to delineate in atomic detail how the family of plant defensins rupture membranes by identifying key phospholipids in the cell membranes of the pathogen. Human defensins have been thought to act through a similar mechanism, targeting cell membrane lipids as part of their function. In fact human beta-defensin 2 have now been shown to kill the pathogenic fungi Candida albicans through interactions with specific phospholipids. From the computational point of view, Molecular Dynamics simulations can provide detailed information about the structure and dynamics of the peptide-membrane interactions, including the orientation, conformation, and insertion of the peptide in the membrane, as well as specific peptide interactions with lipids, ions and solvent.
Sources: en.wikipedia.org
After synthesizing and purifying the core, the carbohydrate layer is added to its surface. Common coating materials are typically polyhydroxy oligomers such as cellobiose, citrate, lactose, and sucrose. This layer seems to be important for the properties of aquasomes, as it influences several drug characteristics including adsorption, molecular stability, and conformation (shape), and acts as a dehydroprotectant. The addition of the carbohydrate layer to the surface of the nanocrystalline core is commonly carried out by passive adsorption through incubation and sonication. Similar to the processing of the core, the carbohydrate layer is subjected to centrifugation, washing, and further sonification followed by heated air drying. Finally, the bioactive molecule of interest is loaded into the carbohydrate layer. This process typically occurs through either lyophilization or passive adsorption, and the fully functionalized aquasome is then characterized.
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
Encapsulin shells compromise icosahedral complexes (12 vertices, 20 faces, 30 edges) formed as a result of self-assembly of protomers. These encapsulin shells have diameters between 24 and 42 nm and are defined by the HK97-fold of their shell protein. The HK97-fold protomer has a roughly triangular shape and consists of three conserved domains: the axial domain, the peripheral domain, and the extended loop. The size and symmetry of the capsid are defined by a triangulation number (T), which determines the number of subunits in the assembly. For example: T = 1 encapsulins (Thermotoga martima) consist of 60 protomers. T = 3 encapsulins (Pyrococcus furiosus) consist of 180 protomers. T = 4 encapsulins (Quasibacillus thermotolerans) consist of 240 protomers.
Once correctly positioned in the membrane via binding of PIP3, Akt can then be phosphorylated by its activating kinases, phosphoinositide-dependent kinase 1 (PDK1) and PDK2. Serine473, the hydrophobic motif, is phosphorylated in an mTORC2-dependent manner, leading some investigators to hypothesize that mTORC2 is the long-sought PDK2 molecule. Threonine308, the activation loop, is phosphorylated by PDK1, allowing full Akt activation. Activated Akt can then go on to activate or deactivate its myriad substrates via its kinase activity. The PHLPPs therefore antagonize PDK1 and PDK2, since they dephosphorylate the site that PDK2 phosphorylates.
Sources: en.wikipedia.org
Annex 13 of the Chicago Convention provides the international Standards And Recommended Practices that form the basis for air accident and incident investigations by signatory countries, as well as reporting and preventive measures. The International Civil Aviation Organization (ICAO) is specifically focused on preventing accidents, rather than determining liability. In Australia, the Australian Transport Safety Bureau is the federal government body responsible for investigating transport-related accidents and incidents, covering air, sea, and rail travel. Formerly an agency of the Department of Infrastructure, Transport, Regional Development and Local Government, in 2010, in the interests of keeping its independence it became a stand-alone agency.
Butyrylcholinesterase deficiency (also known as pseudocholinesterase deficiency, and Succinylcholine Sensitivity is an autosomal recessive inherited blood plasma enzyme abnormality in which the body's production of butyrylcholinesterase (BChE) is impaired. People who have this abnormality may be sensitive to certain anesthetic drugs, including the muscle relaxants succinylcholine and mivacurium as well as other ester local anesthetics. It is classed as an inborn error of metabolism in ICD11.
The Wnt signaling pathway can be divided in canonical and non-canonical. The canonical signaling involves binding of Wnt to Frizzled and LRP5 co-receptor, leading to GSK3 phosphorylation and inhibition of β-catenin degradation, resulting in its accumulation and translocation to the nucleus, where it acts as a transcription factor. The non-canonical Wnt signaling can be divided in planar cell polarity (PCP) pathway and Wnt/calcium pathway. It is characterized by binding of Wnt to Frizzled and activation of G proteins and to an increase of intracellular levels of calcium through mechanisms involving PKC 50. The Wnt signaling pathway plays a significant role in osteoblastogenesis and bone formation, inducing the differentiation of mesenquimal pluripotent cells in osteoblasts and inhibiting the RANKL/RANK pathway and osteoclastogenesis.
Sources: en.wikipedia.org
Yes, the World Anti-Doping Agency classifies AOD-9604 as a prohibited peptide hormone and related substance. Its use by athletes is banned under the relevant anti-doping code.
Confirmatory detection typically uses liquid chromatography with mass spectrometry. Immunoassays may be used for screening, but mass spectrometry provides structural confirmation.
No widely approved therapeutic indication exists for AOD-9604. It has been investigated in clinical studies, but regulatory approvals for general medical use are not established.
Lyophilized AOD9604 is generally kept at -20 °C or colder, desiccated, and protected from light. Reconstituted solutions are usually refrigerated and handled to minimize repeated freeze-thaw cycles. These are general laboratory handling practices, not instructions for human use.